#!/bin/sh

do_help() {
  cat <<EOF
  
Usage: esample [ -docsum | -article | -book | -protein | -gene | -taxon | -blast | -snp | -bioc ]

EOF
}

do_docsum() {
  cat <<EOF
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE DocumentSummarySet>
<DocumentSummarySet status="OK">
  <DocumentSummary>
    <Id>6301692</Id>
    <PubDate>1983 Apr</PubDate>
    <Source>Cell</Source>
    <Authors>
      <Author>
        <Name>Krasnow MA</Name>
        <AuthType>Author</AuthType>
      </Author>
      <Author>
        <Name>Cozzarelli NR</Name>
        <AuthType>Author</AuthType>
      </Author>
    </Authors>
    <LastAuthor>Cozzarelli NR</LastAuthor>
    <Title>Site-specific relaxation and recombination by the Tn3 resolvase: recognition of the DNA path between oriented res sites.</Title>
    <SortTitle>site specific relaxation and recombination by the tn3 resolvase recognition of the dna path between oriented res sites</SortTitle>
    <Volume>32</Volume>
    <Issue>4</Issue>
    <Pages>1313-24</Pages>
    <Lang>
      <string>eng</string>
    </Lang>
    <NlmUniqueID>0413066</NlmUniqueID>
    <ISSN>0092-8674</ISSN>
    <ESSN>1097-4172</ESSN>
    <PubType>
      <flag>Journal Article</flag>
    </PubType>
    <RecordStatus>PubMed - indexed for MEDLINE</RecordStatus>
    <PubStatus>4</PubStatus>
    <ArticleIds>
      <ArticleId>
        <IdType>pubmed</IdType>
        <IdTypeN>1</IdTypeN>
        <Value>6301692</Value>
      </ArticleId>
      <ArticleId>
        <IdType>pii</IdType>
        <IdTypeN>4</IdTypeN>
        <Value>0092-8674(83)90312-4</Value>
      </ArticleId>
      <ArticleId>
        <IdType>doi</IdType>
        <IdTypeN>3</IdTypeN>
        <Value>10.1016/0092-8674(83)90312-4</Value>
      </ArticleId>
      <ArticleId>
        <IdType>rid</IdType>
        <IdTypeN>8</IdTypeN>
        <Value>6301692</Value>
      </ArticleId>
      <ArticleId>
        <IdType>eid</IdType>
        <IdTypeN>8</IdTypeN>
        <Value>6301692</Value>
      </ArticleId>
    </ArticleIds>
    <History>
      <PubMedPubDate>
        <PubStatus>pubmed</PubStatus>
        <Date>1983/04/01 00:00</Date>
      </PubMedPubDate>
      <PubMedPubDate>
        <PubStatus>medline</PubStatus>
        <Date>1983/04/01 00:01</Date>
      </PubMedPubDate>
      <PubMedPubDate>
        <PubStatus>entrez</PubStatus>
        <Date>1983/04/01 00:00</Date>
      </PubMedPubDate>
    </History>
    <Attributes>
      <flag>Has Abstract</flag>
    </Attributes>
    <PmcRefCount>57</PmcRefCount>
    <FullJournalName>Cell</FullJournalName>
    <DocType>citation</DocType>
    <SortPubDate>1983/04/01 00:00</SortPubDate>
    <SortFirstAuthor>Krasnow MA</SortFirstAuthor>
  </DocumentSummary>
</DocumentSummarySet>
EOF
}

do_article() {
  cat <<EOF
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE PubmedArticle>
<PubmedArticle>
  <MedlineCitation Status="MEDLINE" Owner="NLM">
    <PMID Version="1">6301692</PMID>
    <DateCompleted>
      <Year>1983</Year>
      <Month>06</Month>
      <Day>17</Day>
    </DateCompleted>
    <DateRevised>
      <Year>2007</Year>
      <Month>11</Month>
      <Day>14</Day>
    </DateRevised>
    <Article PubModel="Print">
      <Journal>
        <ISSN IssnType="Print">0092-8674</ISSN>
        <JournalIssue CitedMedium="Print">
          <Volume>32</Volume>
          <Issue>4</Issue>
          <PubDate>
            <Year>1983</Year>
            <Month>Apr</Month>
          </PubDate>
        </JournalIssue>
        <Title>Cell</Title>
        <ISOAbbreviation>Cell</ISOAbbreviation>
      </Journal>
      <ArticleTitle>Site-specific relaxation and recombination by the Tn3 resolvase: recognition of the DNA path between oriented res sites.</ArticleTitle>
      <Pagination>
        <MedlinePgn>1313-24</MedlinePgn>
      </Pagination>
      <Abstract>
        <AbstractText Label="RESULTS>We studied the dynamics of site-specific recombination by the resolvase encoded by the Escherichia coli transposon Tn3.
The pure enzyme recombined supercoiled plasmids containing two directly repeated recombination sites, called res sites.
Resolvase is the first strictly site-specific topoisomerase.
It relaxed only plasmids containing directly repeated res sites; substrates with zero, one or two inverted sites were inert.
Even when the proximity of res sites was ensured by catenation of plasmids with a single site, neither relaxation nor recombination occurred.
The two circular products of recombination were catenanes interlinked only once.
These properties of resolvase require that the path of the DNA between res sites be clearly defined and that strand exchange occur with a unique geometry.</AbstractText>
        <AbstractText Label="SUMMARY">A model in which one subunit of a dimeric resolvase is bound at one res site,
while the other searches along adjacent DNA until it encounters the second site,
would account for the ability of resolvase to distinguish intramolecular from intermolecular sites,
to sense the relative orientation of sites and to produce singly interlinked catenanes.
Because resolvase is a type 1 topoisomerase, we infer that it makes the required duplex bDNA breaks of recombination one strand at a time.</AbstractText>
      </Abstract>
      <AuthorList CompleteYN="Y">
        <Author ValidYN="Y">
          <LastName>Krasnow</LastName>
          <ForeName>Mark A</ForeName>
          <Initials>MA</Initials>
        </Author>
        <Author ValidYN="Y">
          <LastName>Cozzarelli</LastName>
          <ForeName>Nicholas R</ForeName>
          <Initials>NR</Initials>
        </Author>
      </AuthorList>
      <Language>eng</Language>
      <GrantList CompleteYN="Y">
        <Grant>
          <GrantID>GM-07281</GrantID>
          <Acronym>GM</Acronym>
          <Agency>NIGMS NIH HHS</Agency>
          <Country>United States</Country>
        </Grant>
      </GrantList>
      <PublicationTypeList>
        <PublicationType UI="D016428">Journal Article</PublicationType>
        <PublicationType UI="D013487">Research Support, U.S. Gov't, P.H.S.</PublicationType>
      </PublicationTypeList>
    </Article>
    <MedlineJournalInfo>
      <Country>United States</Country>
      <MedlineTA>Cell</MedlineTA>
      <NlmUniqueID>0413066</NlmUniqueID>
      <ISSNLinking>0092-8674</ISSNLinking>
    </MedlineJournalInfo>
    <ChemicalList>
      <Chemical>
        <RegistryNumber>0</RegistryNumber>
        <NameOfSubstance UI="D004269">DNA, Bacterial</NameOfSubstance>
      </Chemical>
      <Chemical>
        <RegistryNumber>0</RegistryNumber>
        <NameOfSubstance UI="D004278">DNA, Superhelical</NameOfSubstance>
      </Chemical>
      <Chemical>
        <RegistryNumber>0</RegistryNumber>
        <NameOfSubstance UI="D004279">DNA, Viral</NameOfSubstance>
      </Chemical>
      <Chemical>
        <RegistryNumber>EC 2.7.7.-</RegistryNumber>
        <NameOfSubstance UI="D009713">Nucleotidyltransferases</NameOfSubstance>
      </Chemical>
      <Chemical>
        <RegistryNumber>EC 2.7.7.-</RegistryNumber>
        <NameOfSubstance UI="D019895">Transposases</NameOfSubstance>
      </Chemical>
      <Chemical>
        <RegistryNumber>EC 5.99.1.2</RegistryNumber>
        <NameOfSubstance UI="D004264">DNA Topoisomerases, Type I</NameOfSubstance>
      </Chemical>
    </ChemicalList>
    <CitationSubset>IM</CitationSubset>
    <MeshHeadingList>
      <MeshHeading>
        <DescriptorName UI="D004264" MajorTopicYN="N">DNA Topoisomerases, Type I</DescriptorName>
        <QualifierName UI="Q000378" MajorTopicYN="N">metabolism</QualifierName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D004269" MajorTopicYN="N">DNA, Bacterial</DescriptorName>
        <QualifierName UI="Q000378" MajorTopicYN="Y">metabolism</QualifierName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D004278" MajorTopicYN="N">DNA, Superhelical</DescriptorName>
        <QualifierName UI="Q000378" MajorTopicYN="N">metabolism</QualifierName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D004279" MajorTopicYN="N">DNA, Viral</DescriptorName>
        <QualifierName UI="Q000378" MajorTopicYN="Y">metabolism</QualifierName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D008957" MajorTopicYN="N">Models, Genetic</DescriptorName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D009690" MajorTopicYN="Y">Nucleic Acid Conformation</DescriptorName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D009713" MajorTopicYN="N">Nucleotidyltransferases</DescriptorName>
        <QualifierName UI="Q000302" MajorTopicYN="N">isolation &amp; purification</QualifierName>
        <QualifierName UI="Q000378" MajorTopicYN="Y">metabolism</QualifierName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D010957" MajorTopicYN="N">Plasmids</DescriptorName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D011995" MajorTopicYN="Y">Recombination, Genetic</DescriptorName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D012091" MajorTopicYN="N">Repetitive Sequences, Nucleic Acid</DescriptorName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D013539" MajorTopicYN="N">Simian virus 40</DescriptorName>
      </MeshHeading>
      <MeshHeading>
        <DescriptorName UI="D019895" MajorTopicYN="N">Transposases</DescriptorName>
      </MeshHeading>
    </MeshHeadingList>
  </MedlineCitation>
  <PubmedData>
    <History>
      <PubMedPubDate PubStatus="pubmed">
        <Year>1983</Year>
        <Month>4</Month>
        <Day>1</Day>
      </PubMedPubDate>
      <PubMedPubDate PubStatus="medline">
        <Year>1983</Year>
        <Month>4</Month>
        <Day>1</Day>
        <Hour>0</Hour>
        <Minute>1</Minute>
      </PubMedPubDate>
      <PubMedPubDate PubStatus="entrez">
        <Year>1983</Year>
        <Month>4</Month>
        <Day>1</Day>
        <Hour>0</Hour>
        <Minute>0</Minute>
      </PubMedPubDate>
    </History>
    <PublicationStatus>ppublish</PublicationStatus>
    <ArticleIdList>
      <ArticleId IdType="pubmed">6301692</ArticleId>
      <ArticleId IdType="pii">0092-8674(83)90312-4</ArticleId>
    </ArticleIdList>
  </PubmedData>
</PubmedArticle>
EOF
}

do_book() {
  cat <<EOF
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE PubmedArticleSet>
<PubmedArticleSet>
  <PubmedBookArticle>
    <BookDocument>
      <PMID Version="1">21433338</PMID>
      <ArticleIdList>
        <ArticleId IdType="bookaccession">NBK19359</ArticleId>
      </ArticleIdList>
      <Book>
        <Publisher>
          <PublisherName>Cold Spring Harbor Laboratory Press</PublisherName>
          <PublisherLocation>Cold Spring Harbor (NY)</PublisherLocation>
        </Publisher>
        <BookTitle book="rv">Retroviruses</BookTitle>
        <PubDate>
          <Year>1997</Year>
        </PubDate>
        <AuthorList Type="editors">
          <Author>
            <LastName>Coffin</LastName>
            <ForeName>John M</ForeName>
            <Initials>JM</Initials>
          </Author>
          <Author>
            <LastName>Hughes</LastName>
            <ForeName>Stephen H</ForeName>
            <Initials>SH</Initials>
          </Author>
          <Author>
            <LastName>Varmus</LastName>
            <ForeName>Harold E</ForeName>
            <Initials>HE</Initials>
          </Author>
        </AuthorList>
        <Isbn>0879695714</Isbn>
      </Book>
      <ArticleTitle book="rv" part="A6253">Pathogenesis of HIV and SIV</ArticleTitle>
      <Language>eng</Language>
      <AuthorList Type="authors">
        <Author>
          <LastName>Fauci</LastName>
          <ForeName>AS</ForeName>
          <Initials>AS</Initials>
        </Author>
        <Author>
          <LastName>Desrosiers</LastName>
          <ForeName>RC</ForeName>
          <Initials>RC</Initials>
        </Author>
      </AuthorList>
      <PublicationType UI="D016454">Review</PublicationType>
      <Abstract>
        <AbstractText>Infections by viruses of the lentivirus genus, most notably human immunodeficiency virus type 1 (HIV-1), are characterized by remarkably complex interactions with the host and a chronic course of disease. Common features of diseases caused by lentiviruses include long and variable incubation periods, persistent viral replication, neurologic manifestations, and destruction of specific hematologic or immunologic cells (Desrosiers and Letvin 1987); some of these characteristics, particularly as they relate to nonprimate lentiviruses, are described in Chapter 10 All lentiviruses exhibit a common morphogenesis and morphology, a tropism for macrophages, extensive genetic and antigenic variability, and the presence of additional regulatory genes not found in other groups of retroviruses. Lentiviruses are not directly oncogenic, although the immune disorders they induce often permit the growth of certain neoplasms, such as lymphomas and Kaposi's sarcoma. Lentiviruses have been isolated from several animal species including sheep, goats, horses, cattle, cats, monkeys, and humans. HIV-1 and HIV-2 are the only known human lentiviruses. Infection of humans with HIV-1 causes a dramatic decline in the number of CD4+ T lymphocytes. When the number of these cells becomes low enough, opportunistic infections and neoplasms occur. Neurologic abnormalities, which occur in a majority of HIV-infected individuals, can be observed in the absence of other clinical manifestations (Fauci 1988). The HIV-related lentiviruses of nonhuman primates are collectively called simian immunodeficiency viruses (SIVs). Related but distinct SIVs have been isolated from several species of African monkeys. SIV and HIV will be referred to as primate lentiviruses; more distant relatives from other animal species will be referred to as nonprimate lentiviruses. As with HIV, infection of an appropriate host with SIV results in the decline of the absolute number of CD4+ T cells, an inversion of the CD4/CD8 T-cell ratio, neurologic abnormalities, and opportunistic infections (Simon et al. 1994).</AbstractText>
        <CopyrightInformation>Copyright © 1997, Cold Spring Harbor Laboratory Press.</CopyrightInformation>
      </Abstract>
      <Sections>
        <Section>
          <SectionTitle book="rv" part="A6254">Etiologic Agents</SectionTitle>
        </Section>
        <Section>
          <SectionTitle book="rv" part="A6265">Cellular Targets of Infection</SectionTitle>
        </Section>
        <Section>
          <SectionTitle book="rv" part="A6269">Course of Infection with HIV and SIV</SectionTitle>
        </Section>
        <Section>
          <SectionTitle book="rv" part="A6284">Immunopathogenic Mechanisms of HIV Infection</SectionTitle>
        </Section>
        <Section>
          <SectionTitle book="rv" part="A6304">Role of Lymphoid Organs in Immunopathogenesis</SectionTitle>
        </Section>
        <Section>
          <SectionTitle book="rv" part="A6308">Pathogenesis of Kaposi's Sarcoma and Other Opportunistic Neoplasms</SectionTitle>
        </Section>
        <Section>
          <SectionTitle book="rv" part="A6311">Tissue-Specific Disease and Organ System Failure</SectionTitle>
        </Section>
        <Section>
          <SectionTitle book="rv" part="A6317">Immune Responses to HIV and SIV</SectionTitle>
        </Section>
        <Section>
          <SectionTitle book="rv" part="A6324">Conclusions</SectionTitle>
        </Section>
        <Section>
          <SectionTitle book="rv" part="A6325">References</SectionTitle>
        </Section>
      </Sections>
    </BookDocument>
    <PubmedBookData>
      <History>
        <PubMedPubDate PubStatus="pubmed">
          <Year>2011</Year>
          <Month>3</Month>
          <Day>25</Day>
          <Hour>6</Hour>
          <Minute>0</Minute>
        </PubMedPubDate>
        <PubMedPubDate PubStatus="medline">
          <Year>2011</Year>
          <Month>3</Month>
          <Day>25</Day>
          <Hour>6</Hour>
          <Minute>0</Minute>
        </PubMedPubDate>
        <PubMedPubDate PubStatus="entrez">
          <Year>2011</Year>
          <Month>3</Month>
          <Day>25</Day>
          <Hour>6</Hour>
          <Minute>0</Minute>
        </PubMedPubDate>
      </History>
      <PublicationStatus>ppublish</PublicationStatus>
      <ArticleIdList>
        <ArticleId IdType="pubmed">21433338</ArticleId>
      </ArticleIdList>
    </PubmedBookData>
  </PubmedBookArticle>
</PubmedArticleSet>
EOF
}

do_protein() {
  cat <<EOF
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE INSDSeq>
<INSDSeq>
  <INSDSeq_locus>AF480315_1</INSDSeq_locus>
  <INSDSeq_length>67</INSDSeq_length>
  <INSDSeq_moltype>AA</INSDSeq_moltype>
  <INSDSeq_topology>linear</INSDSeq_topology>
  <INSDSeq_division>INV</INSDSeq_division>
  <INSDSeq_update-date>25-JUL-2016</INSDSeq_update-date>
  <INSDSeq_create-date>31-DEC-2003</INSDSeq_create-date>
  <INSDSeq_definition>four-loop conotoxin preproprotein, partial [Conus purpurascens]</INSDSeq_definition>
  <INSDSeq_primary-accession>AAQ05867</INSDSeq_primary-accession>
  <INSDSeq_accession-version>AAQ05867.1</INSDSeq_accession-version>
  <INSDSeq_other-seqids>
    <INSDSeqid>gb|AAQ05867.1|AF480315_1</INSDSeqid>
    <INSDSeqid>gi|33320307</INSDSeqid>
  </INSDSeq_other-seqids>
  <INSDSeq_source>Conus purpurascens</INSDSeq_source>
  <INSDSeq_organism>Conus purpurascens</INSDSeq_organism>
  <INSDSeq_taxonomy>Eukaryota; Metazoa; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Hypsogastropoda; Neogastropoda; Conoidea; Conidae; Conus</INSDSeq_taxonomy>
  <INSDSeq_references>
    <INSDReference>
      <INSDReference_reference>1</INSDReference_reference>
      <INSDReference_position>1..67</INSDReference_position>
      <INSDReference_authors>
        <INSDAuthor>Duda,T.F. Jr.</INSDAuthor>
        <INSDAuthor>Palumbi,S.R.</INSDAuthor>
      </INSDReference_authors>
      <INSDReference_title>Convergent evolution of venoms and feeding ecologies among polyphyletic piscivorous Conus species</INSDReference_title>
      <INSDReference_journal>Unpublished</INSDReference_journal>
    </INSDReference>
    <INSDReference>
      <INSDReference_reference>2</INSDReference_reference>
      <INSDReference_position>1..67</INSDReference_position>
      <INSDReference_authors>
        <INSDAuthor>Duda,T.F. Jr.</INSDAuthor>
        <INSDAuthor>Palumbi,S.R.</INSDAuthor>
      </INSDReference_authors>
      <INSDReference_title>Direct Submission</INSDReference_title>
      <INSDReference_journal>Submitted (04-FEB-2002) Naos Marine Lab, Smithsonian Tropical Research Institute, Apartado 2072, Balboa, Ancon, Panama, Republic of Panama</INSDReference_journal>
    </INSDReference>
  </INSDSeq_references>
  <INSDSeq_comment>Method: conceptual translation supplied by author.</INSDSeq_comment>
  <INSDSeq_source-db>accession AF480315.1</INSDSeq_source-db>
  <INSDSeq_feature-table>
    <INSDFeature>
      <INSDFeature_key>source</INSDFeature_key>
      <INSDFeature_location>1..67</INSDFeature_location>
      <INSDFeature_intervals>
        <INSDInterval>
          <INSDInterval_from>1</INSDInterval_from>
          <INSDInterval_to>67</INSDInterval_to>
          <INSDInterval_accession>AAQ05867.1</INSDInterval_accession>
        </INSDInterval>
      </INSDFeature_intervals>
      <INSDFeature_quals>
        <INSDQualifier>
          <INSDQualifier_name>organism</INSDQualifier_name>
          <INSDQualifier_value>Conus purpurascens</INSDQualifier_value>
        </INSDQualifier>
        <INSDQualifier>
          <INSDQualifier_name>isolate</INSDQualifier_name>
          <INSDQualifier_value>purpurascens-2c</INSDQualifier_value>
        </INSDQualifier>
        <INSDQualifier>
          <INSDQualifier_name>db_xref</INSDQualifier_name>
          <INSDQualifier_value>taxon:41690</INSDQualifier_value>
        </INSDQualifier>
        <INSDQualifier>
          <INSDQualifier_name>clone_lib</INSDQualifier_name>
          <INSDQualifier_value>venom duct cDNA library</INSDQualifier_value>
        </INSDQualifier>
        <INSDQualifier>
          <INSDQualifier_name>country</INSDQualifier_name>
          <INSDQualifier_value>Panama</INSDQualifier_value>
        </INSDQualifier>
        <INSDQualifier>
          <INSDQualifier_name>note</INSDQualifier_name>
          <INSDQualifier_value>isolated from the Bay of Panama</INSDQualifier_value>
        </INSDQualifier>
      </INSDFeature_quals>
    </INSDFeature>
    <INSDFeature>
      <INSDFeature_key>Protein</INSDFeature_key>
      <INSDFeature_location>&lt;1..67</INSDFeature_location>
      <INSDFeature_intervals>
        <INSDInterval>
          <INSDInterval_from>1</INSDInterval_from>
          <INSDInterval_to>67</INSDInterval_to>
          <INSDInterval_accession>AAQ05867.1</INSDInterval_accession>
        </INSDInterval>
      </INSDFeature_intervals>
      <INSDFeature_partial5 value="true"/>
      <INSDFeature_quals>
        <INSDQualifier>
          <INSDQualifier_name>product</INSDQualifier_name>
          <INSDQualifier_value>four-loop conotoxin preproprotein</INSDQualifier_value>
        </INSDQualifier>
      </INSDFeature_quals>
    </INSDFeature>
    <INSDFeature>
      <INSDFeature_key>mat_peptide</INSDFeature_key>
      <INSDFeature_location>41..67</INSDFeature_location>
      <INSDFeature_intervals>
        <INSDInterval>
          <INSDInterval_from>41</INSDInterval_from>
          <INSDInterval_to>67</INSDInterval_to>
          <INSDInterval_accession>AAQ05867.1</INSDInterval_accession>
        </INSDInterval>
      </INSDFeature_intervals>
      <INSDFeature_quals>
        <INSDQualifier>
          <INSDQualifier_name>product</INSDQualifier_name>
          <INSDQualifier_value>four-loop conotoxin</INSDQualifier_value>
        </INSDQualifier>
        <INSDQualifier>
          <INSDQualifier_name>calculated_mol_wt</INSDQualifier_name>
          <INSDQualifier_value>3008</INSDQualifier_value>
        </INSDQualifier>
        <INSDQualifier>
          <INSDQualifier_name>peptide</INSDQualifier_name>
          <INSDQualifier_value>PCKKTGRKCFPHQKDCCGRACIITICP</INSDQualifier_value>
        </INSDQualifier>
      </INSDFeature_quals>
    </INSDFeature>
    <INSDFeature>
      <INSDFeature_key>CDS</INSDFeature_key>
      <INSDFeature_location>1..67</INSDFeature_location>
      <INSDFeature_intervals>
        <INSDInterval>
          <INSDInterval_from>1</INSDInterval_from>
          <INSDInterval_to>67</INSDInterval_to>
          <INSDInterval_accession>AAQ05867.1</INSDInterval_accession>
        </INSDInterval>
      </INSDFeature_intervals>
      <INSDFeature_partial5 value="true"/>
      <INSDFeature_quals>
        <INSDQualifier>
          <INSDQualifier_name>coded_by</INSDQualifier_name>
          <INSDQualifier_value>AF480315.1:&lt;1..205</INSDQualifier_value>
        </INSDQualifier>
        <INSDQualifier>
          <INSDQualifier_name>codon_start</INSDQualifier_name>
          <INSDQualifier_value>2</INSDQualifier_value>
        </INSDQualifier>
      </INSDFeature_quals>
    </INSDFeature>
  </INSDSeq_feature-table>
  <INSDSeq_sequence>vvivavlfltacqlitaddsrrtqkhralrsttkratsnrpckktgrkcfphqkdccgraciiticp</INSDSeq_sequence>
</INSDSeq>
EOF
}

do_gene() {
  cat <<EOF
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE DocumentSummary>
<DocumentSummary>
  <Id>3581</Id>
  <Name>IL9R</Name>
  <Description>interleukin 9 receptor</Description>
  <Status>0</Status>
  <CurrentID>0</CurrentID>
  <Chromosome>X, Y</Chromosome>
  <GeneticSource>genomic</GeneticSource>
  <MapLocation>Xq28 and Yq12</MapLocation>
  <OtherAliases>CD129, IL-9R</OtherAliases>
  <OtherDesignations>interleukin-9 receptor|IL-9 receptor</OtherDesignations>
  <NomenclatureSymbol>IL9R</NomenclatureSymbol>
  <NomenclatureName>interleukin 9 receptor</NomenclatureName>
  <NomenclatureStatus>Official</NomenclatureStatus>
  <Mim>
    <int>300007</int>
  </Mim>
  <GenomicInfo>
    <GenomicInfoType>
      <ChrLoc>X</ChrLoc>
      <ChrAccVer>NC_000023.11</ChrAccVer>
      <ChrStart>155997580</ChrStart>
      <ChrStop>156013016</ChrStop>
      <ExonCount>14</ExonCount>
    </GenomicInfoType>
    <GenomicInfoType>
      <ChrLoc>Y</ChrLoc>
      <ChrAccVer>NC_000024.10</ChrAccVer>
      <ChrStart>57184100</ChrStart>
      <ChrStop>57199536</ChrStop>
      <ExonCount>14</ExonCount>
    </GenomicInfoType>
  </GenomicInfo>
  <GeneWeight>5425</GeneWeight>
  <Summary>The protein encoded by this gene is a cytokine receptor that specifically mediates the biological effects of interleukin 9 (IL9).
The functional IL9 receptor complex requires this protein as well as the interleukin 2 receptor, gamma (IL2RG), a common gamma subunit shared by the receptors of many different cytokines.
The ligand binding of this receptor leads to the activation of various JAK kinases and STAT proteins, which connect to different biologic responses.
This gene is located at the pseudoautosomal regions of X and Y chromosomes.
Genetic studies suggested an association of this gene with the development of asthma.
Multiple pseudogenes on chromosome 9, 10, 16, and 18 have been described.
Alternatively spliced transcript variants have been found for this gene.</Summary>
  <ChrSort>X</ChrSort>
  <ChrStart>155997580</ChrStart>
  <Organism>
    <ScientificName>Homo sapiens</ScientificName>
    <CommonName>human</CommonName>
    <TaxID>9606</TaxID>
  </Organism>
</DocumentSummary>
EOF
}

do_taxon() {
  cat <<EOF
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE TaxaSet>
<TaxaSet>
  <Taxon>
    <TaxId>9606</TaxId>
    <ScientificName>Homo sapiens</ScientificName>
    <OtherNames>
      <GenbankCommonName>human</GenbankCommonName>
      <CommonName>man</CommonName>
      <Name>
        <ClassCDE>authority</ClassCDE>
        <DispName>Homo sapiens Linnaeus, 1758</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Home sapiens</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo sampiens</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo sapeins</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo sapian</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo sapians</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo sapien</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo sapience</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo sapiense</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo sapients</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo sapines</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo spaiens</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Homo spiens</DispName>
      </Name>
      <Name>
        <ClassCDE>misspelling</ClassCDE>
        <DispName>Humo sapiens</DispName>
      </Name>
    </OtherNames>
    <ParentTaxId>9605</ParentTaxId>
    <Rank>species</Rank>
    <Division>Primates</Division>
    <GeneticCode>
      <GCId>1</GCId>
      <GCName>Standard</GCName>
    </GeneticCode>
    <MitoGeneticCode>
      <MGCId>2</MGCId>
      <MGCName>Vertebrate Mitochondrial</MGCName>
    </MitoGeneticCode>
    <Lineage>cellular organisms; Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea; Hominidae; Homininae; Homo</Lineage>
    <LineageEx>
      <Taxon>
        <TaxId>131567</TaxId>
        <ScientificName>cellular organisms</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>2759</TaxId>
        <ScientificName>Eukaryota</ScientificName>
        <Rank>superkingdom</Rank>
      </Taxon>
      <Taxon>
        <TaxId>33154</TaxId>
        <ScientificName>Opisthokonta</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>33208</TaxId>
        <ScientificName>Metazoa</ScientificName>
        <Rank>kingdom</Rank>
      </Taxon>
      <Taxon>
        <TaxId>6072</TaxId>
        <ScientificName>Eumetazoa</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>33213</TaxId>
        <ScientificName>Bilateria</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>33511</TaxId>
        <ScientificName>Deuterostomia</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>7711</TaxId>
        <ScientificName>Chordata</ScientificName>
        <Rank>phylum</Rank>
      </Taxon>
      <Taxon>
        <TaxId>89593</TaxId>
        <ScientificName>Craniata</ScientificName>
        <Rank>subphylum</Rank>
      </Taxon>
      <Taxon>
        <TaxId>7742</TaxId>
        <ScientificName>Vertebrata</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>7776</TaxId>
        <ScientificName>Gnathostomata</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>117570</TaxId>
        <ScientificName>Teleostomi</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>117571</TaxId>
        <ScientificName>Euteleostomi</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>8287</TaxId>
        <ScientificName>Sarcopterygii</ScientificName>
        <Rank>superclass</Rank>
      </Taxon>
      <Taxon>
        <TaxId>1338369</TaxId>
        <ScientificName>Dipnotetrapodomorpha</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>32523</TaxId>
        <ScientificName>Tetrapoda</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>32524</TaxId>
        <ScientificName>Amniota</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>40674</TaxId>
        <ScientificName>Mammalia</ScientificName>
        <Rank>class</Rank>
      </Taxon>
      <Taxon>
        <TaxId>32525</TaxId>
        <ScientificName>Theria</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>9347</TaxId>
        <ScientificName>Eutheria</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>1437010</TaxId>
        <ScientificName>Boreoeutheria</ScientificName>
        <Rank>no rank</Rank>
      </Taxon>
      <Taxon>
        <TaxId>314146</TaxId>
        <ScientificName>Euarchontoglires</ScientificName>
        <Rank>superorder</Rank>
      </Taxon>
      <Taxon>
        <TaxId>9443</TaxId>
        <ScientificName>Primates</ScientificName>
        <Rank>order</Rank>
      </Taxon>
      <Taxon>
        <TaxId>376913</TaxId>
        <ScientificName>Haplorrhini</ScientificName>
        <Rank>suborder</Rank>
      </Taxon>
      <Taxon>
        <TaxId>314293</TaxId>
        <ScientificName>Simiiformes</ScientificName>
        <Rank>infraorder</Rank>
      </Taxon>
      <Taxon>
        <TaxId>9526</TaxId>
        <ScientificName>Catarrhini</ScientificName>
        <Rank>parvorder</Rank>
      </Taxon>
      <Taxon>
        <TaxId>314295</TaxId>
        <ScientificName>Hominoidea</ScientificName>
        <Rank>superfamily</Rank>
      </Taxon>
      <Taxon>
        <TaxId>9604</TaxId>
        <ScientificName>Hominidae</ScientificName>
        <Rank>family</Rank>
      </Taxon>
      <Taxon>
        <TaxId>207598</TaxId>
        <ScientificName>Homininae</ScientificName>
        <Rank>subfamily</Rank>
      </Taxon>
      <Taxon>
        <TaxId>9605</TaxId>
        <ScientificName>Homo</ScientificName>
        <Rank>genus</Rank>
      </Taxon>
    </LineageEx>
    <CreateDate>1995/02/27 09:24:00</CreateDate>
    <UpdateDate>2018/11/23 13:57:51</UpdateDate>
    <PubDate>1992/05/26 01:00:00</PubDate>
  </Taxon>
</TaxaSet>
EOF
}

do_blast() {
  cat <<EOF
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE BlastOutput>
<BlastOutput>
  <BlastOutput_program>blastx</BlastOutput_program>
  <BlastOutput_version>BLASTX 2.2.29+</BlastOutput_version>
  <BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&amp;auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), &quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
  <BlastOutput_db>nr</BlastOutput_db>
  <BlastOutput_query-ID>11471</BlastOutput_query-ID>
  <BlastOutput_query-def>Contig2</BlastOutput_query-def>
  <BlastOutput_query-len>620</BlastOutput_query-len>
  <BlastOutput_param>
    <Parameters>
      <Parameters_matrix>BLOSUM62</Parameters_matrix>
      <Parameters_expect>3</Parameters_expect>
      <Parameters_gap-open>11</Parameters_gap-open>
      <Parameters_gap-extend>1</Parameters_gap-extend>
      <Parameters_filter>L;</Parameters_filter>
    </Parameters>
  </BlastOutput_param>
  <BlastOutput_iterations>
    <Iteration>
      <Iteration_iter-num>1</Iteration_iter-num>
      <Iteration_query-ID>11471</Iteration_query-ID>
      <Iteration_query-def>Contig2</Iteration_query-def>
      <Iteration_query-len>620</Iteration_query-len>
      <Iteration_hits>
        <Hit>
          <Hit_num>1</Hit_num>
          <Hit_id>gi|115476212|ref|NP_001061702.1|</Hit_id>
          <Hit_def>Os08g0384500 [Oryza sativa Japonica Group] &gt;gi|113623671|dbj|BAF23616.1| Os08g0384500, partial [Oryza sativa Japonica Group]</Hit_def>
          <Hit_accession>NP_001061702</Hit_accession>
          <Hit_len>763</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>357.066</Hsp_bit-score>
              <Hsp_score>915</Hsp_score>
              <Hsp_evalue>1.61032e-117</Hsp_evalue>
              <Hsp_query-from>8</Hsp_query-from>
              <Hsp_query-to>619</Hsp_query-to>
              <Hsp_hit-from>187</Hsp_hit-from>
              <Hsp_hit-to>390</Hsp_hit-to>
              <Hsp_query-frame>2</Hsp_query-frame>
              <Hsp_hit-frame>0</Hsp_hit-frame>
              <Hsp_identity>183</Hsp_identity>
              <Hsp_positive>195</Hsp_positive>
              <Hsp_gaps>0</Hsp_gaps>
              <Hsp_align-len>204</Hsp_align-len>
              <Hsp_qseq>DDRLLLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGEIKISGYPKKQETFSRISGYCEQNDIHSPYVTLYESLLYSAWLRLPSDVNETQRKLFVEEVMNLVELSPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDXXXXXXXXXXXXNTVDTGRTVVCTIHQPSIDIFEAFDELFLI</Hsp_qseq>
              <Hsp_hseq>QDRLLLLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDISISGYPKKQETFARVSGYCEQNDIHSPNVTVYESLAYSAWLRLPSDVDSETRKMFIEQVMELVELNPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLM</Hsp_hseq>
              <Hsp_midline>DRLLLLKGVSG+FRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G+I ISGYPKKQETF+R+SGYCEQNDIHSP VT+YESL YSAWLRLPSDV+ RK+F+E+VM LVEL+PLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMR VRNTVDTGRTVVCTIHQPSIDIFEAFDELFL+</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>2</Hit_num>
          <Hit_id>gi|218188640|gb|EEC71067.1|</Hit_id>
          <Hit_def>hypothetical protein OsI_02819 [Oryza sativa Indica Group]</Hit_def>
          <Hit_accession>EEC71067</Hit_accession>
          <Hit_len>517</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>344.354</Hsp_bit-score>
              <Hsp_score>882</Hsp_score>
              <Hsp_evalue>2.11484e-115</Hsp_evalue>
              <Hsp_query-from>8</Hsp_query-from>
              <Hsp_query-to>619</Hsp_query-to>
              <Hsp_hit-from>8</Hsp_hit-from>
              <Hsp_hit-to>211</Hsp_hit-to>
              <Hsp_query-frame>2</Hsp_query-frame>
              <Hsp_hit-frame>0</Hsp_hit-frame>
              <Hsp_identity>175</Hsp_identity>
              <Hsp_positive>197</Hsp_positive>
              <Hsp_gaps>0</Hsp_gaps>
              <Hsp_align-len>204</Hsp_align-len>
              <Hsp_qseq>DDRLLLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGEIKISGYPKKQETFSRISGYCEQNDIHSPYVTLYESLLYSAWLRLPSDVNETQRKLFVEEVMNLVELSPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDXXXXXXXXXXXXNTVDTGRTVVCTIHQPSIDIFEAFDELFLI</Hsp_qseq>
              <Hsp_hseq>EERVLLLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDMRISGYPKKQETLARISGYCEQNDIHSPHVTVYESLVFSAWLRLPSEVDSEARKMFIEEVMDLVELTSLRGALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFDELFLM</Hsp_hseq>
              <Hsp_midline>++R+LLLKGVSG+FRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G+++ISGYPKKQET +RISGYCEQNDIHSP+VT+YESL++SAWLRLPS+V+ RK+F+EEVM+LVEL+ LR ALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMR VRNTV+TGRTVVCTIHQPSIDIFEAFDELFL+</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>3</Hit_num>
          <Hit_id>gi|222640481|gb|EEE68613.1|</Hit_id>
          <Hit_def>hypothetical protein OsJ_27150 [Oryza sativa Japonica Group]</Hit_def>
          <Hit_accession>EEE68613</Hit_accession>
          <Hit_len>1199</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>357.066</Hsp_bit-score>
              <Hsp_score>915</Hsp_score>
              <Hsp_evalue>4.01633e-114</Hsp_evalue>
              <Hsp_query-from>8</Hsp_query-from>
              <Hsp_query-to>619</Hsp_query-to>
              <Hsp_hit-from>623</Hsp_hit-from>
              <Hsp_hit-to>826</Hsp_hit-to>
              <Hsp_query-frame>2</Hsp_query-frame>
              <Hsp_hit-frame>0</Hsp_hit-frame>
              <Hsp_identity>183</Hsp_identity>
              <Hsp_positive>195</Hsp_positive>
              <Hsp_gaps>0</Hsp_gaps>
              <Hsp_align-len>204</Hsp_align-len>
              <Hsp_qseq>DDRLLLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGEIKISGYPKKQETFSRISGYCEQNDIHSPYVTLYESLLYSAWLRLPSDVNETQRKLFVEEVMNLVELSPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDXXXXXXXXXXXXNTVDTGRTVVCTIHQPSIDIFEAFDELFLI</Hsp_qseq>
              <Hsp_hseq>QDRLLLLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDISISGYPKKQETFARVSGYCEQNDIHSPNVTVYESLAYSAWLRLPSDVDSETRKMFIEQVMELVELNPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLM</Hsp_hseq>
              <Hsp_midline>DRLLLLKGVSG+FRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G+I ISGYPKKQETF+R+SGYCEQNDIHSP VT+YESL YSAWLRLPSDV+ RK+F+E+VM LVEL+PLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMR VRNTVDTGRTVVCTIHQPSIDIFEAFDELFL+</Hsp_midline>
            </Hsp>
            <Hsp>
              <Hsp_num>2</Hsp_num>
              <Hsp_bit-score>44.669</Hsp_bit-score>
              <Hsp_score>104</Hsp_score>
              <Hsp_evalue>0.00011956</Hsp_evalue>
              <Hsp_query-from>293</Hsp_query-from>
              <Hsp_query-to>619</Hsp_query-to>
              <Hsp_hit-from>49</Hsp_hit-from>
              <Hsp_hit-to>158</Hsp_hit-to>
              <Hsp_query-frame>2</Hsp_query-frame>
              <Hsp_hit-frame>0</Hsp_hit-frame>
              <Hsp_identity>30</Hsp_identity>
              <Hsp_positive>58</Hsp_positive>
              <Hsp_gaps>1</Hsp_gaps>
              <Hsp_align-len>110</Hsp_align-len>
              <Hsp_qseq>DVNETQRKLFVEEVMNLVELSPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDXXXXXXXXXXXXN-TVDTGRTVVCTIHQPSIDIFEAFDELFLI</Hsp_qseq>
              <Hsp_hseq>SVGGQETNIITDYVLKILGLDICADTIVGNEMLRGISGGQRKRVTTGEMIVGPARAMFMDEISTGLDSSTTFQIVKSLGQITSILGGTTVISLLQPAPETYNLFDDIILL</Hsp_hseq>
              <Hsp_midline>V + + + V+ ++ L D +VG + G+S QRKR+T +V +FMDE ++GLD+ +++++ T G T V ++ QP+ + + FD++ L+</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
      </Iteration_hits>
      <Iteration_stat>
        <Statistics>
          <Statistics_db-num>160101</Statistics_db-num>
          <Statistics_db-len>61990885</Statistics_db-len>
          <Statistics_hsp-len>0</Statistics_hsp-len>
          <Statistics_eff-space>0</Statistics_eff-space>
          <Statistics_kappa>0.041</Statistics_kappa>
          <Statistics_lambda>0.267</Statistics_lambda>
          <Statistics_entropy>0.14</Statistics_entropy>
        </Statistics>
      </Iteration_stat>
    </Iteration>
  </BlastOutput_iterations>
</BlastOutput>
EOF
}

do_snp() {
  cat <<EOF
{
  "refsnp_id": "1238141906",
  "create_date": "2017-11-9T09:55Z",
  "last_update_date": "2018-10-13T04:05Z",
  "last_update_build_id": "152",
  "dbsnp1_merges": [],
  "citations": [],
  "lost_obs_movements": [],
  "present_obs_movements": [
    {
      "component_ids": [
        {
          "type": "subsnp",
          "value": "3625249109"
        }
      ],
      "observation": {
        "seq_id": "NC_000023.11",
        "position": 154187777,
        "deleted_sequence": "G",
        "inserted_sequence": "G"
      },
      "allele_in_cur_release": {
        "seq_id": "NC_000023.11",
        "position": 154187777,
        "deleted_sequence": "G",
        "inserted_sequence": "G"
      },
      "other_rsids_in_cur_release": [],
      "previous_release": {
        "allele": {
          "seq_id": "NC_000023.11",
          "position": 154187777,
          "deleted_sequence": "G",
          "inserted_sequence": "G"
        },
        "rsids": [
          "1238141906"
        ]
      },
      "last_added_to_this_rs": "151"
    },
    {
      "component_ids": [
        {
          "type": "subsnp",
          "value": "3625249109"
        }
      ],
      "observation": {
        "seq_id": "NC_000023.11",
        "position": 154187777,
        "deleted_sequence": "G",
        "inserted_sequence": "A"
      },
      "allele_in_cur_release": {
        "seq_id": "NC_000023.11",
        "position": 154187777,
        "deleted_sequence": "G",
        "inserted_sequence": "A"
      },
      "other_rsids_in_cur_release": [],
      "previous_release": {
        "allele": {
          "seq_id": "NC_000023.11",
          "position": 154187777,
          "deleted_sequence": "G",
          "inserted_sequence": "A"
        },
        "rsids": [
          "1238141906"
        ]
      },
      "last_added_to_this_rs": "151"
    }
  ],
  "primary_snapshot_data": {
    "placements_with_allele": [
      {
        "seq_id": "NC_000023.11",
        "is_ptlp": true,
        "placement_annot": {
          "seq_type": "refseq_chromosome",
          "mol_type": "genomic",
          "seq_id_traits_by_assembly": [
            {
              "assembly_name": "GRCh38.p12",
              "assembly_accession": "GCF_000001405.38",
              "is_top_level": true,
              "is_alt": false,
              "is_patch": false,
              "is_chromosome": true
            }
          ],
          "is_aln_opposite_orientation": false,
          "is_mismatch": false
        },
        "alleles": [
          {
            "allele": {
              "spdi": {
                "seq_id": "NC_000023.11",
                "position": 154187777,
                "deleted_sequence": "G",
                "inserted_sequence": "G"
              }
            },
            "hgvs": "NC_000023.11:g.154187778G="
          },
          {
            "allele": {
              "spdi": {
                "seq_id": "NC_000023.11",
                "position": 154187777,
                "deleted_sequence": "G",
                "inserted_sequence": "A"
              }
            },
            "hgvs": "NC_000023.11:g.154187778G>A"
          }
        ]
      },
      {
        "seq_id": "NW_003871103.3",
        "is_ptlp": false,
        "placement_annot": {
          "seq_type": "refseq_chromosome",
          "mol_type": "genomic",
          "seq_id_traits_by_assembly": [
            {
              "assembly_name": "GRCh37.p13",
              "assembly_accession": "GCF_000001405.25",
              "is_top_level": true,
              "is_alt": false,
              "is_patch": true,
              "is_chromosome": false
            }
          ],
          "is_aln_opposite_orientation": false,
          "is_mismatch": false
        },
        "alleles": [
          {
            "allele": {
              "spdi": {
                "seq_id": "NW_003871103.3",
                "position": 1621756,
                "deleted_sequence": "G",
                "inserted_sequence": "G"
              }
            },
            "hgvs": "NW_003871103.3:g.1621757G="
          },
          {
            "allele": {
              "spdi": {
                "seq_id": "NW_003871103.3",
                "position": 1621756,
                "deleted_sequence": "G",
                "inserted_sequence": "A"
              }
            },
            "hgvs": "NW_003871103.3:g.1621757G>A"
          }
        ]
      },
      {
        "seq_id": "NG_011606.1",
        "is_ptlp": false,
        "placement_annot": {
          "seq_type": "refseq_genomic",
          "mol_type": "genomic",
          "seq_id_traits_by_assembly": [],
          "is_aln_opposite_orientation": false,
          "is_mismatch": false
        },
        "alleles": [
          {
            "allele": {
              "spdi": {
                "seq_id": "NG_011606.1",
                "position": 10182,
                "deleted_sequence": "G",
                "inserted_sequence": "G"
              }
            },
            "hgvs": "NG_011606.1:g.10183G="
          },
          {
            "allele": {
              "spdi": {
                "seq_id": "NG_011606.1",
                "position": 10182,
                "deleted_sequence": "G",
                "inserted_sequence": "A"
              }
            },
            "hgvs": "NG_011606.1:g.10183G>A"
          }
        ]
      },
      {
        "seq_id": "NM_000513.2",
        "is_ptlp": false,
        "placement_annot": {
          "seq_type": "refseq_mrna",
          "mol_type": "rna",
          "seq_id_traits_by_assembly": [],
          "is_aln_opposite_orientation": false,
          "is_mismatch": false
        },
        "alleles": [
          {
            "allele": {
              "spdi": {
                "seq_id": "NM_000513.2",
                "position": 202,
                "deleted_sequence": "G",
                "inserted_sequence": "G"
              }
            },
            "hgvs": "NM_000513.2:c.121G="
          },
          {
            "allele": {
              "spdi": {
                "seq_id": "NM_000513.2",
                "position": 202,
                "deleted_sequence": "G",
                "inserted_sequence": "A"
              }
            },
            "hgvs": "NM_000513.2:c.121G>A"
          }
        ]
      },
      {
        "seq_id": "NC_000023.10",
        "is_ptlp": false,
        "placement_annot": {
          "seq_type": "refseq_chromosome",
          "mol_type": "genomic",
          "seq_id_traits_by_assembly": [
            {
              "assembly_name": "GRCh37.p13",
              "assembly_accession": "GCF_000001405.25",
              "is_top_level": true,
              "is_alt": false,
              "is_patch": false,
              "is_chromosome": true
            }
          ],
          "is_aln_opposite_orientation": false,
          "is_mismatch": false
        },
        "alleles": [
          {
            "allele": {
              "spdi": {
                "seq_id": "NC_000023.10",
                "position": 153453266,
                "deleted_sequence": "G",
                "inserted_sequence": "G"
              }
            },
            "hgvs": "NC_000023.10:g.153453267G="
          },
          {
            "allele": {
              "spdi": {
                "seq_id": "NC_000023.10",
                "position": 153453266,
                "deleted_sequence": "G",
                "inserted_sequence": "A"
              }
            },
            "hgvs": "NC_000023.10:g.153453267G>A"
          }
        ]
      },
      {
        "seq_id": "NP_000504.1",
        "is_ptlp": false,
        "placement_annot": {
          "seq_type": "refseq_prot",
          "mol_type": "protein",
          "seq_id_traits_by_assembly": [],
          "is_aln_opposite_orientation": false,
          "is_mismatch": false
        },
        "alleles": [
          {
            "allele": {
              "spdi": {
                "seq_id": "NP_000504.1",
                "position": 40,
                "deleted_sequence": "E",
                "inserted_sequence": "E"
              }
            },
            "hgvs": "NP_000504.1:p.Glu41="
          },
          {
            "allele": {
              "spdi": {
                "seq_id": "NP_000504.1",
                "position": 40,
                "deleted_sequence": "E",
                "inserted_sequence": "K"
              }
            },
            "hgvs": "NP_000504.1:p.Glu41Lys"
          }
        ]
      }
    ],
    "allele_annotations": [
      {
        "frequency": [],
        "clinical": [],
        "submissions": [
          "3625249109"
        ],
        "assembly_annotation": [
          {
            "seq_id": "NC_000023.11",
            "annotation_release": "Homo sapiens Annotation Release 109",
            "genes": [
              {
                "name": "opsin 1, medium wave sensitive",
                "id": 2652,
                "locus": "OPN1MW",
                "is_pseudo": false,
                "orientation": "plus",
                "sequence_ontology": [],
                "rnas": [
                  {
                    "id": "NM_000513.2",
                    "codon_aligned_transcript_change": {
                      "seq_id": "NM_000513.2",
                      "position": 202,
                      "deleted_sequence": "GAA",
                      "inserted_sequence": "GAA"
                    },
                    "sequence_ontology": [
                      {
                        "name": "coding_sequence_variant",
                        "accession": "SO:0001580"
                      }
                    ],
                    "product_id": "NP_000504.1",
                    "protein": {
                      "variant": {
                        "spdi": {
                          "seq_id": "NP_000504.1",
                          "position": 40,
                          "deleted_sequence": "E",
                          "inserted_sequence": "E"
                        }
                      },
                      "sequence_ontology": []
                    }
                  }
                ]
              }
            ]
          }
        ]
      },
      {
        "frequency": [],
        "clinical": [],
        "submissions": [
          "3625249109"
        ],
        "assembly_annotation": [
          {
            "seq_id": "NC_000023.11",
            "annotation_release": "Homo sapiens Annotation Release 109",
            "genes": [
              {
                "name": "opsin 1, medium wave sensitive",
                "id": 2652,
                "locus": "OPN1MW",
                "is_pseudo": false,
                "orientation": "plus",
                "sequence_ontology": [],
                "rnas": [
                  {
                    "id": "NM_000513.2",
                    "codon_aligned_transcript_change": {
                      "seq_id": "NM_000513.2",
                      "position": 202,
                      "deleted_sequence": "GAA",
                      "inserted_sequence": "AAA"
                    },
                    "sequence_ontology": [
                      {
                        "name": "coding_sequence_variant",
                        "accession": "SO:0001580"
                      }
                    ],
                    "product_id": "NP_000504.1",
                    "protein": {
                      "variant": {
                        "spdi": {
                          "seq_id": "NP_000504.1",
                          "position": 40,
                          "deleted_sequence": "E",
                          "inserted_sequence": "K"
                        }
                      },
                      "sequence_ontology": [
                        {
                          "name": "missense_variant",
                          "accession": "SO:0001583"
                        }
                      ]
                    }
                  }
                ]
              }
            ]
          }
        ]
      }
    ],
    "support": [
      {
        "id": {
          "type": "subsnp",
          "value": "ss3625249109"
        },
        "revision_added": "151",
        "create_date": "2017-11-8T14:58Z",
        "submitter_handle": "TOPMED"
      }
    ],
    "anchor": "NC_000023.11:0154187777:1:snv",
    "variant_type": "snv"
  }
}
EOF
}

do_bioc() {
  cat <<EOF
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE collection>
<collection>
  <source>PubMed</source>
  <date>20171216</date>
  <key>collection.key</key>
  <document>
    <id>6301692</id>
    <passage>
      <infon key="type">title</infon>
      <offset>0</offset>
      <text>Site-specific relaxation and recombination by the Tn3 resolvase: recognition of the DNA path between oriented res sites.</text>
    </passage>
    <passage>
      <infon key="type">abstract</infon>
      <offset>121</offset>
      <text>We studied the dynamics of site-specific recombination by the resolvase encoded by the Escherichia coli transposon Tn3. The pure enzyme recombined supercoiled plasmids containing two directly repeated recombination sites, called res sites. Resolvase is the first strictly site-specific topoisomerase. It relaxed only plasmids containing directly repeated res sites; substrates with zero, one or two inverted sites were inert. Even when the proximity of res sites was ensured by catenation of plasmids with a single site, neither relaxation nor recombination occurred. The two circular products of recombination were catenanes interlinked only once. These properties of resolvase require that the path of the DNA between res sites be clearly defined and that strand exchange occur with a unique geometry. A model in which one subunit of a dimeric resolvase is bound at one res site, while the other searches along adjacent DNA until it encounters the second site, would account for the ability of resolvase to distinguish intramolecular from intermolecular sites, to sense the relative orientation of sites and to produce singly interlinked catenanes. Because resolvase is a type 1 topoisomerase, we infer that it makes the required duplex bDNA breaks of recombination one strand at a time.</text>
    </passage>
  </document>
</collection>
EOF
}

do_error() {
  cat <<EOF
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE eInfoResult>
<eInfoResult>
  <ERROR>Can not retrieve DbInfo for db=all</ERROR>
</eInfoResult>
EOF
}

choice="help"

if [ $# -gt 0 ]
then
  choice="$1"
fi

case "$choice" in
    help | -help )
     do_help 
     ;;
    docsum | -docsum )
     do_docsum 
     ;;
    article | -article | pubmed | -pubmed )
     do_article 
     ;;
    book | -book )
     do_book 
     ;;
    protein | -protein )
     do_protein 
     ;;
    gene | -gene )
     do_gene 
     ;;
    taxon | -taxon )
     do_taxon 
     ;;
    blast | -blast )
     do_blast 
     ;;
    snp | -snp )
     do_snp 
     ;;
    bioc | -bioc )
     do_bioc 
     ;;
    error | -error )
     do_error 
     ;;
esac
